Name :
PIP5K3 (Human) Recombinant Protein (Q01)
Biological Activity :
Human PIP5K3 partial ORF ( NP_689884, 342 a.a. – 451 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_689884
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=200576
Amino Acid Sequence :
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
PIP5K3
Gene Alias :
CFD, FAB1, KIAA0981, MGC40423, PIKFYVE, PIP5K
Gene Description :
phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
Gene Summary :
PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM
Other Designations :
1-phosphatidylinositol-4-phosphate 5-kinase|FYVE finger-containing phosphoinositide kinase|OTTHUMP00000163872|PtdIns(4)P-5-kinase|phosphatidylinositol-3-phosphate 5-kinase type III|phosphatidylinositol-4-phosphate 5-kinase, type III
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Growth Differentiation Factor web
Cathepsin A Proteincustom synthesis
Popular categories:
Immunoglobulin Superfamily Member 11 (IGSF11)
FGF-13
