Name :
MCMDC1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human MCMDC1 partial ORF ( AAH31658, 1 a.a. – 100 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH31658
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=254394
Amino Acid Sequence :
MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
Molecular Weight :
36.41
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
MCM9
Gene Alias :
C6orf61, FLJ13942, FLJ20170, FLJ56845, MCMDC1, MGC35304, dJ329L24.1, dJ329L24.3
Gene Description :
minichromosome maintenance complex component 9
Gene Summary :
This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication. [provided by RefSeq
Other Designations :
OTTHUMP00000017098|OTTHUMP00000017099|OTTHUMP00000017100|OTTHUMP00000040388|minichromosome maintenance 9|minichromosome maintenance deficient domain containing 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-1/CD80 MedChemExpress
Insulin-like Growth Factor I (IGF-1) site
Popular categories:
Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
Cadherin-26
