Share this post on:

Name :
Il1a (Mouse) Recombinant Protein

Biological Activity :
Mouse Il1a (Q3U0Y6, 115 a.a. – 279 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
Q3U0Y6

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=16175

Amino Acid Sequence :
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSA_x005f
_x005f
241AYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Weight :
17.9

Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from sterile distilled Water up to 0.1 – 1.0 mg/ml

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Il1a

Gene Alias :
Il-1a

Gene Description :
interleukin 1 alpha

Gene Summary :

Other Designations :
OTTMUSP00000016430

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-4 Proteincustom synthesis
PDGFR web
Popular categories:
Ubiquitin-Specific Peptidase 19
Integrin alpha M beta 2

Share this post on:

Author: Proteasome inhibitor