Name :
Dkk1 (Mouse) Recombinant Protein
Biological Activity :
Mouse Dkk1 (O54908, 32 a.a. – 272 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
O54908
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=13380
Amino Acid Sequence :
TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR
Molecular Weight :
26.9
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (HEK 293) expression system
Purification :
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of Dkk1 (Mouse) Recombinant Protein.
Storage Buffer :
In 50mM MES buffer, pH 6.5 (30% glycerol)
Applications :
SDS-PAGE，
Gene Name :
Dkk1
Gene Alias :
mdkk-1
Gene Description :
dickkopf homolog 1 (Xenopus laevis)
Gene Summary :
Other Designations :
OTTMUSP00000022079|dickkopf homolog 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-11 site
MIG/CXCL9 ProteinPurity & Documentation
Popular categories:
CD45
CD131
