Name :
GDF7 (Human) Recombinant Protein
Biological Activity :
Human GDF7 partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q7Z4P5
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=151449
Amino Acid Sequence :
TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Molecular Weight :
28
Storage and Stability :
Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Lyophilized from a solution containing HCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Applications :
Functional Study，
Gene Name :
GDF7
Gene Alias :
BMP12
Gene Description :
growth differentiation factor 7
Gene Summary :
This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq
Other Designations :
OTTHUMP00000115986
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF ProteinSpecies
Cathepsin A Proteinmedchemexpress
Popular categories:
Serpin B5/Maspin
Angiopoietin-Like 7
