Name :
Mydgf (Mouse) Recombinant Protein
Biological Activity :
Mouse Mydgf (P58546, 25 a.a. – 166 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q9CPT4
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=28106
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL.
Molecular Weight :
18.1
Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
20mM Tris-HCl (pH8.0), 0.1M NaCl and 10% glycerol.
Applications :
SDS-PAGE，
Gene Name :
D17Wsu104e
Gene Alias :
Il25, Ly6elg
Gene Description :
DNA segment, Chr 17, Wayne State University 104, expressed
Gene Summary :
DNA segment
Other Designations :
C19orf10-like|hypothetical protein LOC28106
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGFR Recombinant Proteins
FGF-18 Proteinweb
Popular categories:
Antithrombin III
Inhibin B
