Name :
CXCL12 (Human) Recombinant Protein
Biological Activity :
Human CXCL12 (P48061, 23 a.a. – 89 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
P48061
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6387
Amino Acid Sequence :
MKHHHHHHASKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular Weight :
9.199999999999999
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water is 0.5 mg/mL
Applications :
SDS-PAGE,
Gene Name :
CXCL12
Gene Alias :
PBSF, SCYB12, SDF-1a, SDF-1b, SDF1, SDF1A, SDF1B, TLSF-a, TLSF-b, TPAR1
Gene Description :
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Gene Summary :
For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM
Other Designations :
OTTHUMP00000019491|stromal cell-derived factor 1 delta|stromal cell-derived factor 1 gamma|stromal cell-derived factor 1a
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-19 ProteinSource
CD51/Integrin alpha V Recombinant Proteins
Popular categories:
CD42d/Platelet Glycoprotein V
IL-2R alpha
