Name :
GCNT2 (Human) Recombinant Protein (Q01)
Biological Activity :
Human GCNT2 partial ORF ( NP_663624, 303 a.a. – 402 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_663624
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2651
Amino Acid Sequence :
TLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Molecular Weight :
36.74
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (90); Rat (83)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
GCNT2
Gene Alias :
CCAT, GCNT2C, GCNT5, IGNT, II, MGC163396, NACGT1, NAGCT1, ULG3, bA360O19.2, bA421M1.1
Gene Description :
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
Gene Summary :
This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations :
I beta-1,6-N-acetylglucosaminyltransferase|I-branching beta-1,6-acetylglucosaminyltransferase|Ii blood group|N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase|OTTHUMP00000016015|OTTHUMP00000016018|OTTHUMP00000016021|beta-1,6-N-acetylglucosami
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HGF web
Carbonic Anhydrase 1 ProteinAccession
Popular categories:
Ubiquitin-Conjugating Enzyme E2 E1
Serine/Threonine Kinase 10
