Share this post on:

Product Name :
RAP Rat

Description :
Recombinant Rat Receptor Associated Protein produced inE.Coli is a single, non-glycosylated polypeptide chain containing 327 aminoacids and having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc,RAP Rat is purified by proprietary chromatographic techniques.

Background :

Biological activity:

Protein number :

Synonyms:
Receptor Associated Protein, RAP.

Amino acid sequence :
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL.

Purity :
Greater than 95.0% as determined by SDS-PAGE.

Source :
Escherichia Coli.

Stablity :
Lyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ING5 ProteinBiological Activity
BCMA/TNFRSF17 ProteinMolecular Weight
Popular categories:
Chorionic Gonadotropin beta Chain (CG-beta)
Ubiquitin-Specific Peptidase 19

Share this post on:

Author: Proteasome inhibitor