Name : Recombinant Human SRY, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
Q05066

Synonyms :
Recombinant Human SRY, N-His

Amino Acid Sequence :

Molecular Weight :
26.19 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human SRY(Met1-Leu204) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
2001-95-8 Description 128446-35-5 medchemexpress PMID:31335087 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant mouse WNT1-inducible-signaling pathway protein 2

Brief Description :
Recombinant Protein

Accession No. :
Q9Z0G4

Calculated MW :
40.5 kDa

Target Sequence :
QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9Z0G4

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Amantadine supplier TudorSN Antibody Cancer PMID:35001515 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human CDH12, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P55289

Synonyms :
Recombinant Human CDH12, N-His

Amino Acid Sequence :

Molecular Weight :
14.89 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human CDH12(Phe421-Lys535) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
84449-90-1 supplier 13010-47-4 manufacturer PMID:30725688 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant human T-box transcription factor TBX15

Brief Description :
Recombinant Protein

Accession No. :
Q96SF7

Calculated MW :
70.4 kDa

Target Sequence :
MSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q96SF7

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1-Deoxynojirimycin Technical Information AGAP1 Antibody Cancer PMID:35202312 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human ABCG1, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P45844

Synonyms :
Recombinant Human ABCG1, N-His

Amino Acid Sequence :

Molecular Weight :
41.01 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human ABCG1(Met1-His353) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
82410-32-0 Biological Activity 26305-03-3 site PMID:31325548 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Sulfolobus islandicus Chromatin protein Cren7

Brief Description :
Recombinant Protein

Accession No. :
C3MPN0

Calculated MW :
33.6 kDa

Target Sequence :
MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
C3N5A6

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cdc25C Antibody Cancer CD182 Antibody Epigenetics PMID:34952119 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human SLC19A1, N-His

Background :

Background :

Biological Activity :

Species :
Human

Expression System :

Protein Accession :
P41440

Synonyms :
Recombinant Human SLC19A1, N-His

Amino Acid Sequence :

Molecular Weight :
16.38 kDa

Purity :
>90% as determined by SDS-PAGE.

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the Human SLC19A1(Leu455-Gln591) was fused with the N-His Tag.

Formulation :
0.01M PBS, pH 7.4, 0.02% NLS

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
1170613-55-4 Formula 241479-67-4 Biological Activity PMID:30475565 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Shigella flexneri serotype X E3 ubiquitin-protein ligase ipaH9.8

Brief Description :
Recombinant Protein

Accession No. :
Q8VSC3

Calculated MW :
66 kDa

Target Sequence :
MLPINNNFSLPQNSFYNTISGTYADYFSAWDKWEKQALPGEERDEAVSRLKECLINNSDELRLDRLNLSSLPDNLPAQITLLNVSYNQLTNLPELPVTLKKLYSASNKLSELPVLPPALESLQVQHNELENLPALPDSLLTMNISYNEIVSLPSLPQALKNLRATRNFLTELPAFSEGNNPVVREYFFDRNQISHIPESILNLRNECSIHISDNPLSSHALPALQRLTSSPDYHGPRIYFSMSDGQQNTLHRPLADAVTAWFPENKQSDVSQIWHAFEHEEHANTFSAFLDRLSDTVSARNTSGFREQVAAWLEKLSASAELRQQSFAVAADATESCEDRVALTWNNLRKTLLVHQASEGLFDNDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEKLQLSTAVKEMRFYGVSGVTANDLRTAEAMVRSREENEFTDWFSLWGPWHAVLKRTEADRWAQAEEQKYEMLENEYPQRVADRLKASGLSGDADAEREAGAQVMRETEQQIYRQLTDEVLALRLPENGSQLHHS

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q8VSC3

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Chromogranin A Antibody Autophagy NK1.1 Antibody custom synthesis PMID:34921578 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name : Recombinant Human Apolipoprotein E/ApoE protein ,C- His Tag

Background :

Background :

Biological Activity :

Species :
Homo sapiens (Human)

Expression System :

Protein Accession :
P02649

Synonyms :
Recombinant Human Apolipoprotein E/ApoE protein ,C- His Tag

Amino Acid Sequence :

Molecular Weight :
32.89kDa

Purity :
>90% as determined by SDS-PAGE

Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.

Endotoxin Level :
Please contact with the lab for this information.

Construction :
A DNA sequence encoding the human ApoE(Lys19-His317) was fused with the C-terminal His Tag

Formulation :
Supplied as solution form in PBS or lyophilized from PBS .

Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
839712-12-8 site 81-24-3 MedChemExpress PMID:30285391 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Recombinant Eschscholzia californica Reticuline oxidase

Brief Description :
Recombinant Protein

Accession No. :
P30986

Calculated MW :
61.4 kDa

Target Sequence :
GNDLLSCLTFNGVRNHTVFSADSDSDFNRFLHLSIQNPLFQNSLISKPSAIILPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILIDLMNLNRVSIDLESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAIDEATSLLHKWQFVAEELEEDFTLSVLGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRFLKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEPNGFIALNGFGGQMSKISSDFTPFPHRSGTRLMVEYIVAWNQSEQKKKTEFLDWLEKVYEFMKPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNAIEISRSWGESYFLSNYERLIRAKTLIDPNNVFNHPQSIPPMANFDYLEKTLGSDGGEVVI

Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P30986

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CD169 Antibody Autophagy hnRNP U Antibody Cancer PMID:35235700 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com